PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P06550_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 839aa    MW: 92720.5 Da    PI: 6.5744
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P06550_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94.1e-191977357
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                           k  ++t+eq+e+Le+l++++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr5P06550_001 19 KYVRYTPEQVEALERLYHECPKPSSMRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 77
                           5679*****************************************************97 PP

2START164.57.8e-521633712205
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s++++g a+ra+g+v  +++  v+e+l+d++ W ++++++e+++v+ +g 
  GSMUA_Achr5P06550_001 163 IAEETLTEFLSKATGTAIEWVQMPGMKPGPDSIGIVAISHGCTGVAARACGLVGLEPT-KVAEILKDRLSWFRDCRSVEIINVLPTGs 249
                            789*******************************************************.8999999999******************* PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g+++l +++ +a+++l+p Rdf+ +Ry+  l++ ++v++++S++s+   p+    +++vRae+lpSg+li+p+++g+s +++v+h d
  GSMUA_Achr5P06550_001 250 nGTIELLYMQVYAPTTLAPaRDFWLLRYTSILEDRSLVVCERSLNSTLGGPSmptVQPFVRAEMLPSGYLIRPCEGGGSVIHIVDHLD 337
                            **********************************************99999888789******************************* PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                            l+ ++++++lr+l++s+++  +kt++ +l+++++
  GSMUA_Achr5P06550_001 338 LEPWSVPEVLRPLYESSTVLSQKTTMVALRHLRQ 371
                            **************************99998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.3E-161682IPR001356Homeobox domain
CDDcd000864.02E-171779No hitNo description
PfamPF000469.0E-171977IPR001356Homeobox domain
SuperFamilySSF466894.71E-171982IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-192177IPR009057Homeodomain-like
PROSITE profilePS5007115.4512278IPR001356Homeobox domain
CDDcd146867.60E-771110No hitNo description
PROSITE profilePS5084824.897153354IPR002913START domain
CDDcd088755.78E-76157373No hitNo description
Gene3DG3DSA:3.30.530.207.1E-22160368IPR023393START-like domain
SMARTSM002341.9E-34162372IPR002913START domain
SuperFamilySSF559615.22E-36162372No hitNo description
PfamPF018521.6E-49163371IPR002913START domain
PfamPF086701.1E-49696838IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010014Biological Processmeristem initiation
GO:0010075Biological Processregulation of meristem growth
GO:0010087Biological Processphloem or xylem histogenesis
GO:0048263Biological Processdetermination of dorsal identity
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MIALTSCEEG KMGIVDPGKY VRYTPEQVEA LERLYHECPK PSSMRRQQLI RECPILSNIE  60
PKQIKVWFQN RRCREKQRKE AARLQAVNRK LTAMNKLLME ENDRLQKQVS QMVYENGYFR  120
QQTQNAALTT TNASCESVVT NGQQHLTPQH PPRDASPAGL MSIAEETLTE FLSKATGTAI  180
EWVQMPGMKP GPDSIGIVAI SHGCTGVAAR ACGLVGLEPT KVAEILKDRL SWFRDCRSVE  240
IINVLPTGSN GTIELLYMQV YAPTTLAPAR DFWLLRYTSI LEDRSLVVCE RSLNSTLGGP  300
SMPTVQPFVR AEMLPSGYLI RPCEGGGSVI HIVDHLDLEP WSVPEVLRPL YESSTVLSQK  360
TTMVALRHLR QIAHETTHSS VSGWGKRPAA LRALSQRLSR GFNEAVNGFV DDGWSMVSSD  420
GMEDITVLVN SSCSKLMGLN LSFVNGCPST TSSVLCAKAT MLLQNISPPM LLRFLREHRS  480
EWADSNIDGY SAASVKAIPH TLPISRTGCS GGQVILPLAH TLEHEEFLEV IKFESIGNNR  540
EMPMPRDLYL LQLCNGVDEN AVGTCSELIF APIDASFADD APLLPSGFRI IPLDFKMDTN  600
SPNRTLDLAS ALEVGPTGSR VHNDYSGNRG NIRSVMTIAF QFAFESHLQE DVASMARQYI  660
RNIIASVQRL SLTLSPSHLG SHGGLRIPPG SPEAATLACW ICHSYRSYSG AEFLKPSADN  720
SDSLLKMLWH HSDAIICCSL KAMPVFTFAN QAGLDMLETT LIALQDITLE KIFVDEGRKM  780
ICAELPHVIQ QGSICLQAGL CISSMGRPVS YERAVAWKVL DNEDNAHCIC FMFVNWSFV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00200DAPTransfer from AT1G52150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399812.10.0PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform X1
SwissprotQ9ZU110.0ATB15_ARATH; Homeobox-leucine zipper protein ATHB-15
TrEMBLM0SW840.0M0SW84_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P06550_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52150.10.0HD-ZIP family protein